SAT2 purified MaxPab mouse polyclonal antibody (B01P) View larger

SAT2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAT2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SAT2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00112483-B01P
Product name: SAT2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SAT2 protein.
Gene id: 112483
Gene name: SAT2
Gene alias: SSAT2
Gene description: spermidine/spermine N1-acetyltransferase family member 2
Genbank accession: NM_133491.2
Immunogen: SAT2 (NP_597998.1, 1 a.a. ~ 170 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Protein accession: NP_597998.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112483-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SAT2 expression in transfected 293T cell line (H00112483-T01) by SAT2 MaxPab polyclonal antibody.

Lane 1: SAT2 transfected lysate(18.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SAT2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart