PRKCDBP monoclonal antibody (M04), clone 8D3 View larger

PRKCDBP monoclonal antibody (M04), clone 8D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKCDBP monoclonal antibody (M04), clone 8D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PRKCDBP monoclonal antibody (M04), clone 8D3

Brand: Abnova
Reference: H00112464-M04
Product name: PRKCDBP monoclonal antibody (M04), clone 8D3
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKCDBP.
Clone: 8D3
Isotype: IgG1 Kappa
Gene id: 112464
Gene name: PRKCDBP
Gene alias: HSRBC|MGC20400|SRBC
Gene description: protein kinase C, delta binding protein
Genbank accession: NM_145040
Immunogen: PRKCDBP (NP_659477, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA
Protein accession: NP_659477
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00112464-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112464-M04-13-15-1.jpg
Application image note: Western Blot analysis of PRKCDBP expression in transfected 293T cell line by PRKCDBP monoclonal antibody (M04), clone 8D3.

Lane 1: PRKCDBP transfected lysate (Predicted MW: 27.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRKCDBP monoclonal antibody (M04), clone 8D3 now

Add to cart