EGLN3 monoclonal antibody (M01), clone 3C5 View larger

EGLN3 monoclonal antibody (M01), clone 3C5

H00112399-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EGLN3 monoclonal antibody (M01), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about EGLN3 monoclonal antibody (M01), clone 3C5

Brand: Abnova
Reference: H00112399-M01
Product name: EGLN3 monoclonal antibody (M01), clone 3C5
Product description: Mouse monoclonal antibody raised against a partial recombinant EGLN3.
Clone: 3C5
Isotype: IgG2a Kappa
Gene id: 112399
Gene name: EGLN3
Gene alias: FLJ21620|HIFPH3|MGC125998|MGC125999|PHD3
Gene description: egl nine homolog 3 (C. elegans)
Genbank accession: BC010992
Immunogen: EGLN3 (AAH10992.2, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EMPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLID
Protein accession: AAH10992.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00112399-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged EGLN3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy EGLN3 monoclonal antibody (M01), clone 3C5 now

Add to cart