MRLC2 monoclonal antibody (M03), clone 1B22 View larger

MRLC2 monoclonal antibody (M03), clone 1B22

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRLC2 monoclonal antibody (M03), clone 1B22

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MRLC2 monoclonal antibody (M03), clone 1B22

Brand: Abnova
Reference: H00103910-M03
Product name: MRLC2 monoclonal antibody (M03), clone 1B22
Product description: Mouse monoclonal antibody raised against a partial recombinant MRLC2.
Clone: 1B22
Isotype: IgG1 Kappa
Gene id: 103910
Gene name: MRLC2
Gene alias: MLC-B
Gene description: myosin regulatory light chain MRLC2
Genbank accession: NM_033546
Immunogen: MRLC2 (NP_291024.1, 73 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Protein accession: NP_291024.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00103910-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MRLC2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MRLC2 monoclonal antibody (M03), clone 1B22 now

Add to cart