EPSTI1 monoclonal antibody (M02A), clone 3G7 View larger

EPSTI1 monoclonal antibody (M02A), clone 3G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPSTI1 monoclonal antibody (M02A), clone 3G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about EPSTI1 monoclonal antibody (M02A), clone 3G7

Brand: Abnova
Reference: H00094240-M02A
Product name: EPSTI1 monoclonal antibody (M02A), clone 3G7
Product description: Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
Clone: 3G7
Isotype: IgG1 Kappa
Gene id: 94240
Gene name: EPSTI1
Gene alias: BRESI1|MGC29634
Gene description: epithelial stromal interaction 1 (breast)
Genbank accession: NM_001002264.1
Immunogen: EPSTI1 (NP_001002264.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Protein accession: NP_001002264.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094240-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EPSTI1 monoclonal antibody (M02A), clone 3G7 now

Add to cart