EPSTI1 monoclonal antibody (M02), clone 3G7 View larger

EPSTI1 monoclonal antibody (M02), clone 3G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPSTI1 monoclonal antibody (M02), clone 3G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about EPSTI1 monoclonal antibody (M02), clone 3G7

Brand: Abnova
Reference: H00094240-M02
Product name: EPSTI1 monoclonal antibody (M02), clone 3G7
Product description: Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
Clone: 3G7
Isotype: IgG1 Kappa
Gene id: 94240
Gene name: EPSTI1
Gene alias: BRESI1|MGC29634
Gene description: epithelial stromal interaction 1 (breast)
Genbank accession: NM_001002264
Immunogen: EPSTI1 (NP_001002264, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Protein accession: NP_001002264
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094240-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094240-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged EPSTI1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Epithelial-Stromal Interaction 1 (EPSTI1) Substitutes for Peritumoral Fibroblasts in the Tumor Microenvironment.de Neergaard M, Kim J, Villadsen R, Fridriksdottir AJ, Rank F, Timmermans-Wielenga V, Langerod A, Borresen-Dale AL, Petersen OW, Ronnov-Jessen L.
Am J Pathol. 2010 Mar;176(3):1229-40. Epub 2010 Feb 4.

Reviews

Buy EPSTI1 monoclonal antibody (M02), clone 3G7 now

Add to cart