EPSTI1 monoclonal antibody (M01), clone 2A8 View larger

EPSTI1 monoclonal antibody (M01), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPSTI1 monoclonal antibody (M01), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about EPSTI1 monoclonal antibody (M01), clone 2A8

Brand: Abnova
Reference: H00094240-M01
Product name: EPSTI1 monoclonal antibody (M01), clone 2A8
Product description: Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
Clone: 2A8
Isotype: IgG1 Kappa
Gene id: 94240
Gene name: EPSTI1
Gene alias: BRESI1|MGC29634
Gene description: epithelial stromal interaction 1 (breast)
Genbank accession: NM_001002264
Immunogen: EPSTI1 (NP_001002264, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Protein accession: NP_001002264
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094240-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094240-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to EPSTI1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EPSTI1 monoclonal antibody (M01), clone 2A8 now

Add to cart