H2AFV monoclonal antibody (M08), clone 2F9 View larger

H2AFV monoclonal antibody (M08), clone 2F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of H2AFV monoclonal antibody (M08), clone 2F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA

More info about H2AFV monoclonal antibody (M08), clone 2F9

Brand: Abnova
Reference: H00094239-M08
Product name: H2AFV monoclonal antibody (M08), clone 2F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant H2AFV.
Clone: 2F9
Isotype: IgG2a Kappa
Gene id: 94239
Gene name: H2AFV
Gene alias: FLJ26479|H2AV|MGC10170|MGC10831|MGC1947
Gene description: H2A histone family, member V
Genbank accession: BC000098
Immunogen: H2AFV (AAH00098, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
Protein accession: AAH00098
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094239-M08-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to H2AFV on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy H2AFV monoclonal antibody (M08), clone 2F9 now

Add to cart