FOXQ1 monoclonal antibody (M25C), clone 3C1 View larger

FOXQ1 monoclonal antibody (M25C), clone 3C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXQ1 monoclonal antibody (M25C), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FOXQ1 monoclonal antibody (M25C), clone 3C1

Brand: Abnova
Reference: H00094234-M25C
Product name: FOXQ1 monoclonal antibody (M25C), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXQ1.
Clone: 3C1
Isotype: IgG2b Kappa
Gene id: 94234
Gene name: FOXQ1
Gene alias: HFH1
Gene description: forkhead box Q1
Genbank accession: NM_033260.3
Immunogen: FOXQ1 (NP_150285.3, 133 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP
Protein accession: NP_150285.3
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094234-M25C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXQ1 monoclonal antibody (M25C), clone 3C1 now

Add to cart