FOXQ1 monoclonal antibody (M10C), clone 2G6 View larger

FOXQ1 monoclonal antibody (M10C), clone 2G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXQ1 monoclonal antibody (M10C), clone 2G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about FOXQ1 monoclonal antibody (M10C), clone 2G6

Brand: Abnova
Reference: H00094234-M10C
Product name: FOXQ1 monoclonal antibody (M10C), clone 2G6
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXQ1.
Clone: 2G6
Isotype: IgG2b Kappa
Gene id: 94234
Gene name: FOXQ1
Gene alias: HFH1
Gene description: forkhead box Q1
Genbank accession: NM_033260
Immunogen: FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
Protein accession: NP_150285
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy FOXQ1 monoclonal antibody (M10C), clone 2G6 now

Add to cart