H00094234-M09J_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Reference: | H00094234-M09J |
Product name: | FOXQ1 monoclonal antibody (M09J), clone 2E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXQ1. |
Clone: | 2E2 |
Isotype: | IgG2b Kappa |
Gene id: | 94234 |
Gene name: | FOXQ1 |
Gene alias: | HFH1 |
Gene description: | forkhead box Q1 |
Genbank accession: | NM_033260 |
Immunogen: | FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR |
Protein accession: | NP_150285 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |