Brand: | Abnova |
Reference: | H00094234-M05 |
Product name: | FOXQ1 monoclonal antibody (M05), clone 2F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXQ1. |
Clone: | 2F2 |
Isotype: | IgG2a Kappa |
Gene id: | 94234 |
Gene name: | FOXQ1 |
Gene alias: | HFH1 |
Gene description: | forkhead box Q1 |
Genbank accession: | NM_033260 |
Immunogen: | FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR |
Protein accession: | NP_150285 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FOXQ1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |