FOXQ1 monoclonal antibody (M05), clone 2F2 View larger

FOXQ1 monoclonal antibody (M05), clone 2F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXQ1 monoclonal antibody (M05), clone 2F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about FOXQ1 monoclonal antibody (M05), clone 2F2

Brand: Abnova
Reference: H00094234-M05
Product name: FOXQ1 monoclonal antibody (M05), clone 2F2
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXQ1.
Clone: 2F2
Isotype: IgG2a Kappa
Gene id: 94234
Gene name: FOXQ1
Gene alias: HFH1
Gene description: forkhead box Q1
Genbank accession: NM_033260
Immunogen: FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
Protein accession: NP_150285
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094234-M05-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FOXQ1 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy FOXQ1 monoclonal antibody (M05), clone 2F2 now

Add to cart