ZNF101 monoclonal antibody (M01), clone 2D5 View larger

ZNF101 monoclonal antibody (M01), clone 2D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF101 monoclonal antibody (M01), clone 2D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF101 monoclonal antibody (M01), clone 2D5

Brand: Abnova
Reference: H00094039-M01
Product name: ZNF101 monoclonal antibody (M01), clone 2D5
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF101.
Clone: 2D5
Isotype: IgG2a Kappa
Gene id: 94039
Gene name: ZNF101
Gene alias: DKFZp570I0164|HZF12|MGC149565|MGC149566
Gene description: zinc finger protein 101
Genbank accession: NM_033204
Immunogen: ZNF101 (NP_149981.2, 112 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LRHSFLDRHMRAHAGHKRSECGGEWRETPRKQKQHGKASISPSSGARRTVTPTRKRPYECKVCGKAFNSPNLFQIHQRTHTGKRSYKCRE
Protein accession: NP_149981.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094039-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094039-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF101 expression in transfected 293T cell line by ZNF101 monoclonal antibody (M01), clone 2D5.

Lane 1: ZNF101 transfected lysate(36.5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF101 monoclonal antibody (M01), clone 2D5 now

Add to cart