Brand: | Abnova |
Reference: | H00094033-M05 |
Product name: | FTMT monoclonal antibody (M05), clone 6G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FTMT. |
Clone: | 6G3 |
Isotype: | IgG2a Kappa |
Gene id: | 94033 |
Gene name: | FTMT |
Gene alias: | MTF |
Gene description: | ferritin mitochondrial |
Genbank accession: | NM_177478 |
Immunogen: | FTMT (NP_803431.1, 143 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN |
Protein accession: | NP_803431.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FTMT monoclonal antibody (M05), clone 6G3. Western Blot analysis of FTMT expression in MCF-7. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |