FTMT monoclonal antibody (M05), clone 6G3 View larger

FTMT monoclonal antibody (M05), clone 6G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FTMT monoclonal antibody (M05), clone 6G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FTMT monoclonal antibody (M05), clone 6G3

Brand: Abnova
Reference: H00094033-M05
Product name: FTMT monoclonal antibody (M05), clone 6G3
Product description: Mouse monoclonal antibody raised against a partial recombinant FTMT.
Clone: 6G3
Isotype: IgG2a Kappa
Gene id: 94033
Gene name: FTMT
Gene alias: MTF
Gene description: ferritin mitochondrial
Genbank accession: NM_177478
Immunogen: FTMT (NP_803431.1, 143 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN
Protein accession: NP_803431.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094033-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094033-M05-1-7-1.jpg
Application image note: FTMT monoclonal antibody (M05), clone 6G3. Western Blot analysis of FTMT expression in MCF-7.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FTMT monoclonal antibody (M05), clone 6G3 now

Add to cart