HTRA3 monoclonal antibody (M03), clone 1F2 View larger

HTRA3 monoclonal antibody (M03), clone 1F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTRA3 monoclonal antibody (M03), clone 1F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about HTRA3 monoclonal antibody (M03), clone 1F2

Brand: Abnova
Reference: H00094031-M03
Product name: HTRA3 monoclonal antibody (M03), clone 1F2
Product description: Mouse monoclonal antibody raised against a partial recombinant HTRA3.
Clone: 1F2
Isotype: IgG2a Kappa
Gene id: 94031
Gene name: HTRA3
Gene alias: Prsp|Tasp
Gene description: HtrA serine peptidase 3
Genbank accession: NM_053044
Immunogen: HTRA3 (NP_444272.1, 344 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM
Protein accession: NP_444272.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094031-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094031-M03-1-4-1.jpg
Application image note: HTRA3 monoclonal antibody (M03), clone 1F2. Western Blot analysis of HTRA3 expression in A-431.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTRA3 monoclonal antibody (M03), clone 1F2 now

Add to cart