CGB7 monoclonal antibody (M01), clone 6F12 View larger

CGB7 monoclonal antibody (M01), clone 6F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CGB7 monoclonal antibody (M01), clone 6F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CGB7 monoclonal antibody (M01), clone 6F12

Brand: Abnova
Reference: H00094027-M01
Product name: CGB7 monoclonal antibody (M01), clone 6F12
Product description: Mouse monoclonal antibody raised against a partial recombinant CGB7.
Clone: 6F12
Isotype: IgG2a Kappa
Gene id: 94027
Gene name: CGB7
Gene alias: CG-beta-a|FLJ35403|FLJ43118
Gene description: chorionic gonadotropin, beta polypeptide 7
Genbank accession: NM_033142
Immunogen: CGB7 (NP_149133, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
Protein accession: NP_149133
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094027-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00094027-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CGB7 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CGB7 monoclonal antibody (M01), clone 6F12 now

Add to cart