PIGS monoclonal antibody (M02), clone 3F3 View larger

PIGS monoclonal antibody (M02), clone 3F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIGS monoclonal antibody (M02), clone 3F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PIGS monoclonal antibody (M02), clone 3F3

Brand: Abnova
Reference: H00094005-M02
Product name: PIGS monoclonal antibody (M02), clone 3F3
Product description: Mouse monoclonal antibody raised against a partial recombinant PIGS.
Clone: 3F3
Isotype: IgG2b Kappa
Gene id: 94005
Gene name: PIGS
Gene alias: DKFZp686K20216|FLJ45226
Gene description: phosphatidylinositol glycan anchor biosynthesis, class S
Genbank accession: NM_033198
Immunogen: PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK
Protein accession: NP_149975.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094005-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00094005-M02-1-8-1.jpg
Application image note: PIGS monoclonal antibody (M02), clone 3F3. Western Blot analysis of PIGS expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PIGS monoclonal antibody (M02), clone 3F3 now

Add to cart