Brand: | Abnova |
Reference: | H00094005-M02 |
Product name: | PIGS monoclonal antibody (M02), clone 3F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIGS. |
Clone: | 3F3 |
Isotype: | IgG2b Kappa |
Gene id: | 94005 |
Gene name: | PIGS |
Gene alias: | DKFZp686K20216|FLJ45226 |
Gene description: | phosphatidylinositol glycan anchor biosynthesis, class S |
Genbank accession: | NM_033198 |
Immunogen: | PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK |
Protein accession: | NP_149975.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | PIGS monoclonal antibody (M02), clone 3F3. Western Blot analysis of PIGS expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |