FOXP2 monoclonal antibody (M02), clone 1F8 View larger

FOXP2 monoclonal antibody (M02), clone 1F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXP2 monoclonal antibody (M02), clone 1F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about FOXP2 monoclonal antibody (M02), clone 1F8

Brand: Abnova
Reference: H00093986-M02
Product name: FOXP2 monoclonal antibody (M02), clone 1F8
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXP2.
Clone: 1F8
Isotype: IgG1 Kappa
Gene id: 93986
Gene name: FOXP2
Gene alias: CAGH44|DKFZp686H1726|SPCH1|TNRC10
Gene description: forkhead box P2
Genbank accession: NM_014491
Immunogen: FOXP2 (NP_055306, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
Protein accession: NP_055306
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093986-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093986-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged FOXP2 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXP2 monoclonal antibody (M02), clone 1F8 now

Add to cart