ACRC monoclonal antibody (M01), clone 2E4 View larger

ACRC monoclonal antibody (M01), clone 2E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACRC monoclonal antibody (M01), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ACRC monoclonal antibody (M01), clone 2E4

Brand: Abnova
Reference: H00093953-M01
Product name: ACRC monoclonal antibody (M01), clone 2E4
Product description: Mouse monoclonal antibody raised against a partial recombinant ACRC.
Clone: 2E4
Isotype: IgG2a Kappa
Gene id: 93953
Gene name: ACRC
Gene alias: NAAR1
Gene description: acidic repeat containing
Genbank accession: NM_052957
Immunogen: ACRC (NP_443189.1, 592 a.a. ~ 691 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV
Protein accession: NP_443189.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093953-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093953-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ACRC is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACRC monoclonal antibody (M01), clone 2E4 now

Add to cart