Brand: | Abnova |
Reference: | H00093661-M01A |
Product name: | CAPZA3 monoclonal antibody (M01A), clone 4D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPZA3. |
Clone: | 4D6 |
Isotype: | IgG2a Kappa |
Gene id: | 93661 |
Gene name: | CAPZA3 |
Gene alias: | CAPPA3|Gsg3 |
Gene description: | capping protein (actin filament) muscle Z-line, alpha 3 |
Genbank accession: | NM_033328 |
Immunogen: | CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII |
Protein accession: | NP_201585 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | CAPZA3 monoclonal antibody (M01A), clone 4D6. Western Blot analysis of CAPZA3 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |