CAPZA3 monoclonal antibody (M01A), clone 4D6 View larger

CAPZA3 monoclonal antibody (M01A), clone 4D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CAPZA3 monoclonal antibody (M01A), clone 4D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about CAPZA3 monoclonal antibody (M01A), clone 4D6

Brand: Abnova
Reference: H00093661-M01A
Product name: CAPZA3 monoclonal antibody (M01A), clone 4D6
Product description: Mouse monoclonal antibody raised against a partial recombinant CAPZA3.
Clone: 4D6
Isotype: IgG2a Kappa
Gene id: 93661
Gene name: CAPZA3
Gene alias: CAPPA3|Gsg3
Gene description: capping protein (actin filament) muscle Z-line, alpha 3
Genbank accession: NM_033328
Immunogen: CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII
Protein accession: NP_201585
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00093661-M01A-1-11-1.jpg
Application image note: CAPZA3 monoclonal antibody (M01A), clone 4D6. Western Blot analysis of CAPZA3 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy CAPZA3 monoclonal antibody (M01A), clone 4D6 now

Add to cart