Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00093659-B01P |
Product name: | CGB5 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CGB5 protein. |
Gene id: | 93659 |
Gene name: | CGB5 |
Gene alias: | HCG|MGC119822 |
Gene description: | chorionic gonadotropin, beta polypeptide 5 |
Genbank accession: | NM_033043.1 |
Immunogen: | CGB5 (NP_149032.1, 1 a.a. ~ 165 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
Protein accession: | NP_149032.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CGB5 expression in transfected 293T cell line (H00093659-T01) by CGB5 MaxPab polyclonal antibody. Lane1:CGB5 transfected lysate(18.15 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |