CGB5 MaxPab mouse polyclonal antibody (B01) View larger

CGB5 MaxPab mouse polyclonal antibody (B01)

H00093659-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CGB5 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CGB5 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00093659-B01
Product name: CGB5 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CGB5 protein.
Gene id: 93659
Gene name: CGB5
Gene alias: HCG|MGC119822
Gene description: chorionic gonadotropin, beta polypeptide 5
Genbank accession: NM_033043.1
Immunogen: CGB5 (NP_149032.1, 1 a.a. ~ 165 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Protein accession: NP_149032.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093659-B01-13-15-1.jpg
Application image note: Western Blot analysis of CGB5 expression in transfected 293T cell line (H00093659-T01) by CGB5 MaxPab polyclonal antibody.

Lane1:CGB5 transfected lysate(18.15 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CGB5 MaxPab mouse polyclonal antibody (B01) now

Add to cart