TJAP1 monoclonal antibody (M01), clone 2E5 View larger

TJAP1 monoclonal antibody (M01), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TJAP1 monoclonal antibody (M01), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TJAP1 monoclonal antibody (M01), clone 2E5

Brand: Abnova
Reference: H00093643-M01
Product name: TJAP1 monoclonal antibody (M01), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant TJAP1.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 93643
Gene name: TJAP1
Gene alias: DKFZp686F06131|PILT|TJP4
Gene description: tight junction associated protein 1 (peripheral)
Genbank accession: NM_080604
Immunogen: TJAP1 (NP_542171.1, 77 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHFRNHK
Protein accession: NP_542171.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093643-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093643-M01-1-25-1.jpg
Application image note: TJAP1 monoclonal antibody (M01), clone 2E5. Western Blot analysis of TJAP1 expression in Hela S3 NE.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TJAP1 monoclonal antibody (M01), clone 2E5 now

Add to cart