Brand: | Abnova |
Reference: | H00093643-M01 |
Product name: | TJAP1 monoclonal antibody (M01), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TJAP1. |
Clone: | 2E5 |
Isotype: | IgG2a Kappa |
Gene id: | 93643 |
Gene name: | TJAP1 |
Gene alias: | DKFZp686F06131|PILT|TJP4 |
Gene description: | tight junction associated protein 1 (peripheral) |
Genbank accession: | NM_080604 |
Immunogen: | TJAP1 (NP_542171.1, 77 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHFRNHK |
Protein accession: | NP_542171.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TJAP1 monoclonal antibody (M01), clone 2E5. Western Blot analysis of TJAP1 expression in Hela S3 NE. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |