MGC16169 monoclonal antibody (M01), clone 7A7 View larger

MGC16169 monoclonal antibody (M01), clone 7A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC16169 monoclonal antibody (M01), clone 7A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about MGC16169 monoclonal antibody (M01), clone 7A7

Brand: Abnova
Reference: H00093627-M01
Product name: MGC16169 monoclonal antibody (M01), clone 7A7
Product description: Mouse monoclonal antibody raised against a partial recombinant MGC16169.
Clone: 7A7
Isotype: IgG2a Kappa
Gene id: 93627
Gene name: MGC16169
Gene alias: HSPC302
Gene description: hypothetical protein MGC16169
Genbank accession: NM_033115
Immunogen: MGC16169 (NP_149106, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRI
Protein accession: NP_149106
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093627-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093627-M01-1-1-1.jpg
Application image note: MGC16169 monoclonal antibody (M01), clone 7A7 Western Blot analysis of MGC16169 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGC16169 monoclonal antibody (M01), clone 7A7 now

Add to cart