Brand: | Abnova |
Reference: | H00093627-M01 |
Product name: | MGC16169 monoclonal antibody (M01), clone 7A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC16169. |
Clone: | 7A7 |
Isotype: | IgG2a Kappa |
Gene id: | 93627 |
Gene name: | MGC16169 |
Gene alias: | HSPC302 |
Gene description: | hypothetical protein MGC16169 |
Genbank accession: | NM_033115 |
Immunogen: | MGC16169 (NP_149106, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRI |
Protein accession: | NP_149106 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MGC16169 monoclonal antibody (M01), clone 7A7 Western Blot analysis of MGC16169 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |