MGC21874 monoclonal antibody (M08), clone 1C8 View larger

MGC21874 monoclonal antibody (M08), clone 1C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC21874 monoclonal antibody (M08), clone 1C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about MGC21874 monoclonal antibody (M08), clone 1C8

Brand: Abnova
Reference: H00093624-M08
Product name: MGC21874 monoclonal antibody (M08), clone 1C8
Product description: Mouse monoclonal antibody raised against a partial recombinant MGC21874.
Clone: 1C8
Isotype: IgG2a Kappa
Gene id: 93624
Gene name: TADA2B
Gene alias: ADA2(beta)|ADA2B|MGC21874
Gene description: transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
Genbank accession: XM_291105
Immunogen: MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Protein accession: XP_291105
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093624-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00093624-M08-3-4-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The double histone acetyltransferase complex ATAC is essential for mammalian development.Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J.
Mol Cell Biol. 2009 Mar;29(5):1176-88. Epub 2008 Dec 22.

Reviews

Buy MGC21874 monoclonal antibody (M08), clone 1C8 now

Add to cart