MGC21874 monoclonal antibody (M06), clone 3F3 View larger

MGC21874 monoclonal antibody (M06), clone 3F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC21874 monoclonal antibody (M06), clone 3F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MGC21874 monoclonal antibody (M06), clone 3F3

Brand: Abnova
Reference: H00093624-M06
Product name: MGC21874 monoclonal antibody (M06), clone 3F3
Product description: Mouse monoclonal antibody raised against a partial recombinant MGC21874.
Clone: 3F3
Isotype: IgG2a Kappa
Gene id: 93624
Gene name: TADA2B
Gene alias: ADA2(beta)|ADA2B|MGC21874
Gene description: transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
Genbank accession: XM_291105
Immunogen: MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Protein accession: XP_291105
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093624-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093624-M06-1-9-1.jpg
Application image note: MGC21874 monoclonal antibody (M06), clone 3F3. Western Blot analysis of MGC21874 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MGC21874 monoclonal antibody (M06), clone 3F3 now

Add to cart