Brand: | Abnova |
Reference: | H00093624-A01 |
Product name: | MGC21874 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MGC21874. |
Gene id: | 93624 |
Gene name: | TADA2B |
Gene alias: | ADA2(beta)|ADA2B|MGC21874 |
Gene description: | transcriptional adaptor 2 (ADA2 homolog, yeast)-beta |
Genbank accession: | XM_291105 |
Immunogen: | MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY |
Protein accession: | XP_291105 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00093624-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00093624-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |