Brand: | Abnova |
Reference: | H00093426-M03 |
Product name: | SYCE1 monoclonal antibody (M03), clone 6G7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SYCE1. |
Clone: | 6G7 |
Isotype: | IgG2a Kappa |
Gene id: | 93426 |
Gene name: | SYCE1 |
Gene alias: | C10orf94|RP11-108K14.6|bA108K14.6 |
Gene description: | synaptonemal complex central element protein 1 |
Genbank accession: | NM_201564.1 |
Immunogen: | SYCE1 (NP_963858.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTWWS |
Protein accession: | NP_963858.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (48.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SYCE1 monoclonal antibody (M03), clone 6G7. Western Blot analysis of SYCE1 expression in A-431. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |