SYCE1 monoclonal antibody (M03), clone 6G7 View larger

SYCE1 monoclonal antibody (M03), clone 6G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYCE1 monoclonal antibody (M03), clone 6G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SYCE1 monoclonal antibody (M03), clone 6G7

Brand: Abnova
Reference: H00093426-M03
Product name: SYCE1 monoclonal antibody (M03), clone 6G7
Product description: Mouse monoclonal antibody raised against a full-length recombinant SYCE1.
Clone: 6G7
Isotype: IgG2a Kappa
Gene id: 93426
Gene name: SYCE1
Gene alias: C10orf94|RP11-108K14.6|bA108K14.6
Gene description: synaptonemal complex central element protein 1
Genbank accession: NM_201564.1
Immunogen: SYCE1 (NP_963858.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTWWS
Protein accession: NP_963858.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093426-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (48.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093426-M03-1-4-1.jpg
Application image note: SYCE1 monoclonal antibody (M03), clone 6G7. Western Blot analysis of SYCE1 expression in A-431.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SYCE1 monoclonal antibody (M03), clone 6G7 now

Add to cart