IGSF8 monoclonal antibody (M01), clone 1E4 View larger

IGSF8 monoclonal antibody (M01), clone 1E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IGSF8 monoclonal antibody (M01), clone 1E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about IGSF8 monoclonal antibody (M01), clone 1E4

Brand: Abnova
Reference: H00093185-M01
Product name: IGSF8 monoclonal antibody (M01), clone 1E4
Product description: Mouse monoclonal antibody raised against a partial recombinant IGSF8.
Clone: 1E4
Isotype: IgG1 Kappa
Gene id: 93185
Gene name: IGSF8
Gene alias: CD316|CD81P3|EWI2|PGRL
Gene description: immunoglobulin superfamily, member 8
Genbank accession: BC004108
Immunogen: IGSF8 (AAH04108, 220 a.a. ~ 322 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT
Protein accession: AAH04108
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093185-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged IGSF8 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy IGSF8 monoclonal antibody (M01), clone 1E4 now

Add to cart