NAPRT1 monoclonal antibody (M01), clone 4A9 View larger

NAPRT1 monoclonal antibody (M01), clone 4A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAPRT1 monoclonal antibody (M01), clone 4A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NAPRT1 monoclonal antibody (M01), clone 4A9

Brand: Abnova
Reference: H00093100-M01
Product name: NAPRT1 monoclonal antibody (M01), clone 4A9
Product description: Mouse monoclonal antibody raised against a full-length recombinant NAPRT1.
Clone: 4A9
Isotype: IgG2a Kappa
Gene id: 93100
Gene name: NAPRT1
Gene alias: PP3856
Gene description: nicotinate phosphoribosyltransferase domain containing 1
Genbank accession: NM_145201.3
Immunogen: NAPRT1 (NP_660202.2, 1 a.a. ~ 466 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQVAAPPPSS
Protein accession: NP_660202.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093100-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093100-M01-13-15-1.jpg
Application image note: Western Blot analysis of NAPRT1 expression in transfected 293T cell line by NAPRT1 monoclonal antibody (M01), clone 4A9.

Lane 1: NAPRT1 transfected lysate(49.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NAPRT1 monoclonal antibody (M01), clone 4A9 now

Add to cart