MARCH9 monoclonal antibody (M01), clone 2B5 View larger

MARCH9 monoclonal antibody (M01), clone 2B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MARCH9 monoclonal antibody (M01), clone 2B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about MARCH9 monoclonal antibody (M01), clone 2B5

Brand: Abnova
Reference: H00092979-M01
Product name: MARCH9 monoclonal antibody (M01), clone 2B5
Product description: Mouse monoclonal antibody raised against a partial recombinant MARCH9.
Clone: 2B5
Isotype: IgG
Gene id: 92979
Gene name: MARCH9
Gene alias: FLJ36578|MARCH-IX|RNF179
Gene description: membrane-associated ring finger (C3HC4) 9
Genbank accession: NM_138396
Immunogen: MARCH9 (NP_612405.2, 240 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT
Protein accession: NP_612405.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092979-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092979-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged MARCH9 is 3 ng/ml as a capture antibody.
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MARCH9 monoclonal antibody (M01), clone 2B5 now

Add to cart