MARS2 monoclonal antibody (M03), clone 7C3 View larger

MARS2 monoclonal antibody (M03), clone 7C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MARS2 monoclonal antibody (M03), clone 7C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about MARS2 monoclonal antibody (M03), clone 7C3

Brand: Abnova
Reference: H00092935-M03
Product name: MARS2 monoclonal antibody (M03), clone 7C3
Product description: Mouse monoclonal antibody raised against a partial recombinant MARS2.
Clone: 7C3
Isotype: IgG2a Kappa
Gene id: 92935
Gene name: MARS2
Gene alias: MetRS|mtMetRS
Gene description: methionyl-tRNA synthetase 2, mitochondrial
Genbank accession: NM_138395
Immunogen: MARS2 (NP_612404, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATA
Protein accession: NP_612404
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092935-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092935-M03-1-7-1.jpg
Application image note: MARS2 monoclonal antibody (M03), clone 7C3. Western Blot analysis of MARS2 expression in MCF-7.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MARS2 monoclonal antibody (M03), clone 7C3 now

Add to cart