Brand: | Abnova |
Reference: | H00092935-M03 |
Product name: | MARS2 monoclonal antibody (M03), clone 7C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MARS2. |
Clone: | 7C3 |
Isotype: | IgG2a Kappa |
Gene id: | 92935 |
Gene name: | MARS2 |
Gene alias: | MetRS|mtMetRS |
Gene description: | methionyl-tRNA synthetase 2, mitochondrial |
Genbank accession: | NM_138395 |
Immunogen: | MARS2 (NP_612404, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATA |
Protein accession: | NP_612404 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MARS2 monoclonal antibody (M03), clone 7C3. Western Blot analysis of MARS2 expression in MCF-7. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |