UBE2Q2 monoclonal antibody (M04), clone 2H3 View larger

UBE2Q2 monoclonal antibody (M04), clone 2H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2Q2 monoclonal antibody (M04), clone 2H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA

More info about UBE2Q2 monoclonal antibody (M04), clone 2H3

Brand: Abnova
Reference: H00092912-M04
Product name: UBE2Q2 monoclonal antibody (M04), clone 2H3
Product description: Mouse monoclonal antibody raised against a partial recombinant UBE2Q2.
Clone: 2H3
Isotype: IgG2a Kappa
Gene id: 92912
Gene name: UBE2Q2
Gene alias: DKFZp762C143
Gene description: ubiquitin-conjugating enzyme E2Q family member 2
Genbank accession: NM_173469
Immunogen: UBE2Q2 (NP_775740, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY
Protein accession: NP_775740
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092912-M04-4-4-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to UBE2Q2 on A-431 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy UBE2Q2 monoclonal antibody (M04), clone 2H3 now

Add to cart