Brand: | Abnova |
Reference: | H00092912-M04 |
Product name: | UBE2Q2 monoclonal antibody (M04), clone 2H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2Q2. |
Clone: | 2H3 |
Isotype: | IgG2a Kappa |
Gene id: | 92912 |
Gene name: | UBE2Q2 |
Gene alias: | DKFZp762C143 |
Gene description: | ubiquitin-conjugating enzyme E2Q family member 2 |
Genbank accession: | NM_173469 |
Immunogen: | UBE2Q2 (NP_775740, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY |
Protein accession: | NP_775740 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to UBE2Q2 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |