OTOP2 monoclonal antibody (M10), clone 4F6 View larger

OTOP2 monoclonal antibody (M10), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OTOP2 monoclonal antibody (M10), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about OTOP2 monoclonal antibody (M10), clone 4F6

Brand: Abnova
Reference: H00092736-M10
Product name: OTOP2 monoclonal antibody (M10), clone 4F6
Product description: Mouse monoclonal antibody raised against a partial recombinant OTOP2.
Clone: 4F6
Isotype: IgG1 Kappa
Gene id: 92736
Gene name: OTOP2
Gene alias: -
Gene description: otopetrin 2
Genbank accession: NM_178160
Immunogen: OTOP2 (NP_835454, 423 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCL
Protein accession: NP_835454
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092736-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092736-M10-1-7-1.jpg
Application image note: OTOP2 monoclonal antibody (M10), clone 4F6. Western Blot analysis of OTOP2 expression in MCF-7(Cat # L046V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OTOP2 monoclonal antibody (M10), clone 4F6 now

Add to cart