MOBKL1A monoclonal antibody (M07), clone 2F8 View larger

MOBKL1A monoclonal antibody (M07), clone 2F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOBKL1A monoclonal antibody (M07), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about MOBKL1A monoclonal antibody (M07), clone 2F8

Brand: Abnova
Reference: H00092597-M07
Product name: MOBKL1A monoclonal antibody (M07), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant MOBKL1A.
Clone: 2F8
Isotype: IgG1 Kappa
Gene id: 92597
Gene name: MOBKL1A
Gene alias: MATS2|MGC33910|MOB4A|Mob1B
Gene description: MOB1, Mps One Binder kinase activator-like 1A (yeast)
Genbank accession: NM_173468
Immunogen: MOBKL1A (NP_775739.1, 120 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
Protein accession: NP_775739.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092597-M07-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MOBKL1A on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy MOBKL1A monoclonal antibody (M07), clone 2F8 now

Add to cart