Brand: | Abnova |
Reference: | H00092597-M07 |
Product name: | MOBKL1A monoclonal antibody (M07), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MOBKL1A. |
Clone: | 2F8 |
Isotype: | IgG1 Kappa |
Gene id: | 92597 |
Gene name: | MOBKL1A |
Gene alias: | MATS2|MGC33910|MOB4A|Mob1B |
Gene description: | MOB1, Mps One Binder kinase activator-like 1A (yeast) |
Genbank accession: | NM_173468 |
Immunogen: | MOBKL1A (NP_775739.1, 120 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR |
Protein accession: | NP_775739.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MOBKL1A on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |