LDHAL6B monoclonal antibody (M04), clone 1C9 View larger

LDHAL6B monoclonal antibody (M04), clone 1C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LDHAL6B monoclonal antibody (M04), clone 1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about LDHAL6B monoclonal antibody (M04), clone 1C9

Brand: Abnova
Reference: H00092483-M04
Product name: LDHAL6B monoclonal antibody (M04), clone 1C9
Product description: Mouse monoclonal antibody raised against a partial recombinant LDHAL6B.
Clone: 1C9
Isotype: IgG2b Kappa
Gene id: 92483
Gene name: LDHAL6B
Gene alias: LDHAL6|LDHL
Gene description: lactate dehydrogenase A-like 6B
Genbank accession: NM_033195
Immunogen: LDHAL6B (NP_005497, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTITKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPEEEAHLKKSAKTLWEIQNKLKL
Protein accession: NP_005497
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092483-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092483-M04-13-15-1.jpg
Application image note: Western Blot analysis of LDHAL6B expression in transfected 293T cell line by LDHAL6B monoclonal antibody (M04), clone 1C9.

Lane 1: LDHAL6B transfected lysate (Predicted MW: 42 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LDHAL6B monoclonal antibody (M04), clone 1C9 now

Add to cart