LDHAL6B monoclonal antibody (M01), clone 1A3 View larger

LDHAL6B monoclonal antibody (M01), clone 1A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LDHAL6B monoclonal antibody (M01), clone 1A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about LDHAL6B monoclonal antibody (M01), clone 1A3

Brand: Abnova
Reference: H00092483-M01
Product name: LDHAL6B monoclonal antibody (M01), clone 1A3
Product description: Mouse monoclonal antibody raised against a partial recombinant LDHAL6B.
Clone: 1A3
Isotype: IgG2b Kappa
Gene id: 92483
Gene name: LDHAL6B
Gene alias: LDHAL6|LDHL
Gene description: lactate dehydrogenase A-like 6B
Genbank accession: NM_033195
Immunogen: LDHAL6B (NP_005497, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVTATAYEIIKMKGYTSWAIGLSVADLTESILKNLRRIHPVSTITKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPEEEAHLKKSAKTLWEIQNKLKL
Protein accession: NP_005497
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092483-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092483-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged LDHAL6B is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LDHAL6B monoclonal antibody (M01), clone 1A3 now

Add to cart