Brand: | Abnova |
Reference: | H00092399-M01 |
Product name: | MRRF monoclonal antibody (M01), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MRRF. |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 92399 |
Gene name: | MRRF |
Gene alias: | MRFF|MTRRF|RRF |
Gene description: | mitochondrial ribosome recycling factor |
Genbank accession: | NM_138777 |
Immunogen: | MRRF (NP_620132, 163 a.a. ~ 262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG |
Protein accession: | NP_620132 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MRRF on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |