MRRF monoclonal antibody (M01), clone 1D3 View larger

MRRF monoclonal antibody (M01), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRRF monoclonal antibody (M01), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about MRRF monoclonal antibody (M01), clone 1D3

Brand: Abnova
Reference: H00092399-M01
Product name: MRRF monoclonal antibody (M01), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant MRRF.
Clone: 1D3
Isotype: IgG2a Kappa
Gene id: 92399
Gene name: MRRF
Gene alias: MRFF|MTRRF|RRF
Gene description: mitochondrial ribosome recycling factor
Genbank accession: NM_138777
Immunogen: MRRF (NP_620132, 163 a.a. ~ 262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG
Protein accession: NP_620132
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092399-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092399-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MRRF on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MRRF monoclonal antibody (M01), clone 1D3 now

Add to cart