Cart 35 Product Products 14 003,57 € (empty)
No products
To be determined Shipping
14 003,57 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 35 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 003,57 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 003,57 €
Data sheet of SCYL1BP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,WB-Tr |
More info about SCYL1BP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00092344-B01P |
| Product name: | SCYL1BP1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SCYL1BP1 protein. |
| Gene id: | 92344 |
| Gene name: | SCYL1BP1 |
| Gene alias: | FLJ11752|MGC51263|MGC70512|NTKL-BP1|NTKLBP1|RP11-545I10.1 |
| Gene description: | SCY1-like 1 binding protein 1 |
| Genbank accession: | BC064945 |
| Immunogen: | SCYL1BP1 (AAH64945.1, 1 a.a. ~ 246 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR |
| Protein accession: | AAH64945.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SCYL1BP1 expression in transfected 293T cell line (H00092344-T01) by SCYL1BP1 MaxPab polyclonal antibody. Lane 1: SCYL1BP1 transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |