LYK5 monoclonal antibody (M02), clone 4E4 View larger

LYK5 monoclonal antibody (M02), clone 4E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LYK5 monoclonal antibody (M02), clone 4E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce

More info about LYK5 monoclonal antibody (M02), clone 4E4

Brand: Abnova
Reference: H00092335-M02
Product name: LYK5 monoclonal antibody (M02), clone 4E4
Product description: Mouse monoclonal antibody raised against a partial recombinant LYK5.
Clone: 4E4
Isotype: IgG2a Kappa
Gene id: 92335
Gene name: STRADA
Gene alias: FLJ90524|LYK5|NY-BR-96|PMSE|STRAD|Stlk
Gene description: STE20-related kinase adaptor alpha
Genbank accession: NM_153335
Immunogen: LYK5 (NP_699166.2, 251 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCS
Protein accession: NP_699166.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092335-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092335-M02-1-25-1.jpg
Application image note: LYK5 monoclonal antibody (M02), clone 4E4. Western Blot analysis of LYK5 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy LYK5 monoclonal antibody (M02), clone 4E4 now

Add to cart