Brand: | Abnova |
Reference: | H00092335-M02 |
Product name: | LYK5 monoclonal antibody (M02), clone 4E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LYK5. |
Clone: | 4E4 |
Isotype: | IgG2a Kappa |
Gene id: | 92335 |
Gene name: | STRADA |
Gene alias: | FLJ90524|LYK5|NY-BR-96|PMSE|STRAD|Stlk |
Gene description: | STE20-related kinase adaptor alpha |
Genbank accession: | NM_153335 |
Immunogen: | LYK5 (NP_699166.2, 251 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCS |
Protein accession: | NP_699166.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LYK5 monoclonal antibody (M02), clone 4E4. Western Blot analysis of LYK5 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |