Brand: | Abnova |
Reference: | H00092335-D01 |
Product name: | STRADA MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human STRADA protein. |
Gene id: | 92335 |
Gene name: | STRADA |
Gene alias: | FLJ90524|LYK5|NY-BR-96|PMSE|STRAD|Stlk |
Gene description: | STE20-related kinase adaptor alpha |
Genbank accession: | NM_153335 |
Immunogen: | STRADA (NP_699166.2, 1 a.a. ~ 348 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCSGG |
Protein accession: | NP_699166.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | STRADA MaxPab rabbit polyclonal antibody. Western Blot analysis of STRADA expression in human kidney. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |