SCGB3A1 monoclonal antibody (M03), clone 3G5 View larger

SCGB3A1 monoclonal antibody (M03), clone 3G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCGB3A1 monoclonal antibody (M03), clone 3G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SCGB3A1 monoclonal antibody (M03), clone 3G5

Brand: Abnova
Reference: H00092304-M03
Product name: SCGB3A1 monoclonal antibody (M03), clone 3G5
Product description: Mouse monoclonal antibody raised against a full-length recombinant SCGB3A1.
Clone: 3G5
Isotype: IgG2a Kappa
Gene id: 92304
Gene name: SCGB3A1
Gene alias: HIN-1|HIN1|LU105|MGC87867|PnSP-2|UGRP2
Gene description: secretoglobin, family 3A, member 1
Genbank accession: BC029176
Immunogen: SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
Protein accession: AAH29176
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092304-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SCGB3A1 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SCGB3A1 monoclonal antibody (M03), clone 3G5 now

Add to cart