GIOT-1 monoclonal antibody (M01), clone 4G11 View larger

GIOT-1 monoclonal antibody (M01), clone 4G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GIOT-1 monoclonal antibody (M01), clone 4G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GIOT-1 monoclonal antibody (M01), clone 4G11

Brand: Abnova
Reference: H00092283-M01
Product name: GIOT-1 monoclonal antibody (M01), clone 4G11
Product description: Mouse monoclonal antibody raised against a partial recombinant GIOT-1.
Clone: 4G11
Isotype: IgG2a Kappa
Gene id: 92283
Gene name: ZNF461
Gene alias: GIOT-1|GIOT1|MGC33911
Gene description: zinc finger protein 461
Genbank accession: NM_153257
Immunogen: GIOT-1 (NP_694989.2, 121 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL
Protein accession: NP_694989.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092283-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092283-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF461 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GIOT-1 monoclonal antibody (M01), clone 4G11 now

Add to cart