MRPS36 monoclonal antibody (M01), clone 3E11 View larger

MRPS36 monoclonal antibody (M01), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS36 monoclonal antibody (M01), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MRPS36 monoclonal antibody (M01), clone 3E11

Brand: Abnova
Reference: H00092259-M01
Product name: MRPS36 monoclonal antibody (M01), clone 3E11
Product description: Mouse monoclonal antibody raised against a full-length recombinant MRPS36.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 92259
Gene name: MRPS36
Gene alias: DC47|MGC22896|MRP-S36
Gene description: mitochondrial ribosomal protein S36
Genbank accession: NM_033281.5
Immunogen: MRPS36 (NP_150597.1, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Protein accession: NP_150597.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092259-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092259-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MRPS36 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MRPS36 monoclonal antibody (M01), clone 3E11 now

Add to cart