Brand: | Abnova |
Reference: | H00092259-M01 |
Product name: | MRPS36 monoclonal antibody (M01), clone 3E11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MRPS36. |
Clone: | 3E11 |
Isotype: | IgG2a Kappa |
Gene id: | 92259 |
Gene name: | MRPS36 |
Gene alias: | DC47|MGC22896|MRP-S36 |
Gene description: | mitochondrial ribosomal protein S36 |
Genbank accession: | NM_033281.5 |
Immunogen: | MRPS36 (NP_150597.1, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE |
Protein accession: | NP_150597.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MRPS36 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |