DC-UbP monoclonal antibody (M03), clone 1D3 View larger

DC-UbP monoclonal antibody (M03), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DC-UbP monoclonal antibody (M03), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DC-UbP monoclonal antibody (M03), clone 1D3

Brand: Abnova
Reference: H00092181-M03
Product name: DC-UbP monoclonal antibody (M03), clone 1D3
Product description: Mouse monoclonal antibody raised against a full length recombinant DC-UbP.
Clone: 1D3
Isotype: IgG1 Kappa
Gene id: 92181
Gene name: UBTD2
Gene alias: DC-UbP|DCUBP|MGC30022
Gene description: ubiquitin domain containing 2
Genbank accession: BC019910
Immunogen: DC-UbP (AAH19910, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN
Protein accession: AAH19910
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092181-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092181-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DC-UbP is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DC-UbP monoclonal antibody (M03), clone 1D3 now

Add to cart