DC-UbP monoclonal antibody (M01), clone 1B8-1B1 View larger

DC-UbP monoclonal antibody (M01), clone 1B8-1B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DC-UbP monoclonal antibody (M01), clone 1B8-1B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about DC-UbP monoclonal antibody (M01), clone 1B8-1B1

Brand: Abnova
Reference: H00092181-M01
Product name: DC-UbP monoclonal antibody (M01), clone 1B8-1B1
Product description: Mouse monoclonal antibody raised against a full length recombinant DC-UbP.
Clone: 1B8-1B1
Isotype: IgG1 kappa
Gene id: 92181
Gene name: UBTD2
Gene alias: DC-UbP|DCUBP|MGC30022
Gene description: ubiquitin domain containing 2
Genbank accession: BC019910
Immunogen: DC-UbP (AAH19910, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQNPTPVEN
Protein accession: AAH19910
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00092181-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092181-M01-1-4-1.jpg
Application image note: DC-UbP monoclonal antibody (M01), clone 1B8-1B1 Western Blot analysis of DC-UbP expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DC-UbP monoclonal antibody (M01), clone 1B8-1B1 now

Add to cart