CHRDL1 monoclonal antibody (M02A), clone 1D10 View larger

CHRDL1 monoclonal antibody (M02A), clone 1D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRDL1 monoclonal antibody (M02A), clone 1D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHRDL1 monoclonal antibody (M02A), clone 1D10

Brand: Abnova
Reference: H00091851-M02A
Product name: CHRDL1 monoclonal antibody (M02A), clone 1D10
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRDL1.
Clone: 1D10
Isotype: IgG1 Kappa
Gene id: 91851
Gene name: CHRDL1
Gene alias: CHL|NRLN1|VOPT|dA141H5.1
Gene description: chordin-like 1
Genbank accession: NM_145234
Immunogen: CHRDL1 (NP_660277, 347 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
Protein accession: NP_660277
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00091851-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHRDL1 monoclonal antibody (M02A), clone 1D10 now

Add to cart