Brand: | Abnova |
Reference: | H00091851-M02 |
Product name: | CHRDL1 monoclonal antibody (M02), clone 1D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRDL1. |
Clone: | 1D10 |
Isotype: | IgG1 Kappa |
Gene id: | 91851 |
Gene name: | CHRDL1 |
Gene alias: | CHL|NRLN1|VOPT|dA141H5.1 |
Gene description: | chordin-like 1 |
Genbank accession: | NM_145234 |
Immunogen: | CHRDL1 (NP_660277, 347 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC |
Protein accession: | NP_660277 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CHRDL1 monoclonal antibody (M02), clone 1D10. Western Blot analysis of CHRDL1 expression in Hela S3 NE. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |