Brand: | Abnova |
Reference: | H00091754-M01 |
Product name: | NEK9 monoclonal antibody (M01), clone 1F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEK9. |
Clone: | 1F6 |
Isotype: | IgG2a Kappa |
Gene id: | 91754 |
Gene name: | NEK9 |
Gene alias: | DKFZp434D0935|MGC138306|MGC16714|NERCC|NERCC1|Nek8 |
Gene description: | NIMA (never in mitosis gene a)- related kinase 9 |
Genbank accession: | BC009336 |
Immunogen: | NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL |
Protein accession: | AAH09336 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | First insight into the kinome of human regulatory T cells.Konig S, Probst-Kepper M, Reinl T, Jeron A, Huehn J, Schraven B, Jansch L. PLoS One. 2012;7(7):e40896. Epub 2012 Jul 16. |