LOC91614 monoclonal antibody (M01), clone 4D9 View larger

LOC91614 monoclonal antibody (M01), clone 4D9

H00091614-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC91614 monoclonal antibody (M01), clone 4D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about LOC91614 monoclonal antibody (M01), clone 4D9

Brand: Abnova
Reference: H00091614-M01
Product name: LOC91614 monoclonal antibody (M01), clone 4D9
Product description: Mouse monoclonal antibody raised against a partial recombinant LOC91614.
Clone: 4D9
Isotype: IgG2a Kappa
Gene id: 91614
Gene name: DEPDC7
Gene alias: TR2|dJ85M6.4
Gene description: DEP domain containing 7
Genbank accession: NM_139160
Immunogen: LOC91614 (NP_631899, 393 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLL
Protein accession: NP_631899
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00091614-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged DEPDC7 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy LOC91614 monoclonal antibody (M01), clone 4D9 now

Add to cart