H00091614-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00091614-M01 |
Product name: | LOC91614 monoclonal antibody (M01), clone 4D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LOC91614. |
Clone: | 4D9 |
Isotype: | IgG2a Kappa |
Gene id: | 91614 |
Gene name: | DEPDC7 |
Gene alias: | TR2|dJ85M6.4 |
Gene description: | DEP domain containing 7 |
Genbank accession: | NM_139160 |
Immunogen: | LOC91614 (NP_631899, 393 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLL |
Protein accession: | NP_631899 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged DEPDC7 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |